DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and tmprss5

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:276 Identity:62/276 - (22%)
Similarity:112/276 - (40%) Gaps:53/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DCG----IPHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLL----- 83
            :||    :|..|.  .|.|.|.:.||...|.......|.|::|.:.:::||||||.:..|     
Zfish   302 ECGTRAKLPRIIG--GVEAALGRWPWQVSLYYNNRHICGGSIITNQWIVTAAHCVHNYRLPQVPS 364

  Fly    84 -------ITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVE 141
                   ||..|.:            |.|  :|.:.|:....::.||.....|||.:::|...:.
Zfish   365 WVVYAGIITSNLAK------------LAQ--YQGFAVERIIYNKNYNHRTHDNDIALVKLKTPLN 415

  Fly   142 YLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAAN--ATSKVLRTMNIDRQPKETCSE--IYG 202
            :.:.|||:|:   .::...:...|....:.|..|..:  ...:||:...:.....:.|:.  :|.
Zfish   416 FSDTIRPVCL---PQYDHDLPGGTQCWISGWGYTQPDDVLIPEVLKEAPVPLISTKKCNSSCMYN 477

  Fly   203 WNMTFEQICAGNTLSQL--CSTDSGAP---QIRKMWHNGSDRYVQLGIASRVKG--QCQNSGILM 260
            ..:|...:|||.:..::  |..|||.|   |...:|.       .:|:.|...|  :..:.|:..
Zfish   478 GEITSRMLCAGYSEGKVDACQGDSGGPLVCQDENVWR-------LVGVVSWGTGCAEPNHPGVYS 535

  Fly   261 DLLSYADWIKRVVRQY 276
            .:..:..||..::..|
Zfish   536 KVAEFLGWIYDIIESY 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 54/246 (22%)
Tryp_SPc 48..269 CDD:214473 52/243 (21%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133 2/3 (67%)
Tryp_SPc 311..544 CDD:214473 56/258 (22%)
Tryp_SPc 312..547 CDD:238113 58/260 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.