DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP012505

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_001688570.1 Gene:AgaP_AGAP012505 / 5668379 VectorBaseID:AGAP012505 Length:283 Species:Anopheles gambiae


Alignment Length:176 Identity:39/176 - (22%)
Similarity:70/176 - (39%) Gaps:42/176 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VICCLWRRVQGFQMLLEED---C-------------GIPHNISERSVNAKLAQN---PWMAYLET 55
            |:||..:......|.:|.:   |             |..|.:|       :|.|   .|.....|
Mosquito   123 VVCCPNKATDPRMMAIENEFNQCEERYRHFTTDQQNGSSHAVS-------IAYNVEIGWQDDRNT 180

  Fly    56 PKGFHCSGTLINHLFVLTAAHCVPD--DLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFR 118
            .  :.|.|.||:...|:::|.|:.:  ||...||:|      .:|..::....|.::..:     
Mosquito   181 T--YACYGYLISTRGVVSSASCLSERADLPNIVRIG------GIDSLDNSRVVPIEKVII----- 232

  Fly   119 HRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQL 164
            |..||.....::|.:::|...|:...::.|.|:: .|....|:.||
Mosquito   233 HPDYNKETLEHNIAIVKLESTVDPSENVFPTCLW-QNITHSPVKQL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 28/119 (24%)
Tryp_SPc 48..269 CDD:214473 28/119 (24%)
AgaP_AGAP012505XP_001688570.1 Tryp_SPc 184..>265 CDD:304450 21/91 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.