powered by:
Protein Alignment CG33462 and AgaP_AGAP012035
DIOPT Version :9
Sequence 1: | NP_995844.2 |
Gene: | CG33462 / 2768841 |
FlyBaseID: | FBgn0053462 |
Length: | 300 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001689264.1 |
Gene: | AgaP_AGAP012035 / 5668016 |
VectorBaseID: | AGAP012035 |
Length: | 197 |
Species: | Anopheles gambiae |
Alignment Length: | 51 |
Identity: | 11/51 - (21%) |
Similarity: | 22/51 - (43%) |
Gaps: | 12/51 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 201 YGWNMTF-EQICAG-NTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRV 249
:.|.|.| ..:..| ..::|.|...:|: |.|.:::|..|::
Mosquito 18 FWWLMLFLVGVAFGQRRVNQACILANGS----------SGRCIRIGECSKI 58
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.