DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP011913

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_001689277.1 Gene:AgaP_AGAP011913 / 5667996 VectorBaseID:AGAP011913 Length:399 Species:Anopheles gambiae


Alignment Length:278 Identity:67/278 - (24%)
Similarity:114/278 - (41%) Gaps:53/278 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RVQGFQMLLEEDC----------GIPHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFV 71
            |.|...:.|..||          |.|...:|..:.|.|..|      ...|.| |..|::....|
Mosquito   139 RCQITALKLACDCGRHKTPTIVNGFPTLTNEYPMMAGLVDN------SLAKVF-CGSTIVTDRHV 196

  Fly    72 LTAAHCVPDDLL--ITVRLGEYNTKTKVDCDNHLCQEPFQE-YNVDMGFRHRYYNANDQTNDIGM 133
            ||||||:.|..:  .:|.:|:.:..|..|       .|:.. |.:....:|..||...:||||.:
Mosquito   197 LTAAHCLLDRTVTGTSVLVGDQDISTGSD-------TPYSSLYRISTFTQHPSYNPTSKTNDIAL 254

  Fly   134 LRLGRRVEYLNHIRPICI---FASNRFQE-PIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPK 194
            ::....:.:...:..:|:   |:::.|:. .:..|.|...    :..|.:::::|:| .:.....
Mosquito   255 VQTFNTIVFNPGVGRVCLPFFFSTSSFENVRLSALGWGAI----DFGAPSSNELLQT-TLTVVSS 314

  Fly   195 ETCSEIYGWNMTFEQIC---AGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKG---QC 253
            .:|.......:...|:|   |||   ..|..|||.|    :::  :|...||..:..|.|   .|
Mosquito   315 TSCGTQLSRTILASQMCTFAAGN---DTCQNDSGGP----LYY--TDPNSQLVYSIGVVGFGVAC 370

  Fly   254 QNS--GILMDLLSYADWI 269
            .:|  .:...:.||.|||
Mosquito   371 ASSFPSVNTRVTSYLDWI 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 56/237 (24%)
Tryp_SPc 48..269 CDD:214473 54/235 (23%)
AgaP_AGAP011913XP_001689277.1 CUB 35..144 CDD:238001 2/4 (50%)
Tryp_SPc 159..391 CDD:238113 62/258 (24%)
Tryp_SPc 159..388 CDD:214473 60/256 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.