DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and LOC562139

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001075159.1 Gene:LOC562139 / 562139 -ID:- Length:263 Species:Danio rerio


Alignment Length:302 Identity:75/302 - (24%)
Similarity:116/302 - (38%) Gaps:69/302 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IIGIAVIC---CLWRRVQGFQMLLEEDCGIPHNISERSVNAKLAQNPWMAYLETPKGFH-CSGTL 65
            :||.|..|   .:...:.|:..::..:..:||:.            ||...|:...||| |.|:|
Zfish    12 LIGTAYGCGVPAIPPVITGYARIVNGEEAVPHSW------------PWQVSLQDSTGFHFCGGSL 64

  Fly    66 INHLFVLTAAHCVPDDLLITVR------LGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNA 124
            ||..:|:|||||       .||      |||::..:..        ||.|...|...|:|..:|.
Zfish    65 INEWWVVTAAHC-------NVRTSHRVILGEHDRSSNA--------EPIQTMTVGKVFKHPNFNM 114

  Fly   125 NDQTNDIGMLRLGRRVEYLNHIRPICIFASN-RFQEPIDQLTWFTTTVWRETAANA--TSKVLRT 186
            ....|||.:::|....:...|:.|:|:..:| .|...:.    ..|:.|..|..||  |..:|:.
Zfish   115 FTINNDILLIKLATPAKINTHVSPVCLAETNDNFPGGMK----CVTSGWGLTKHNAPDTPALLQQ 175

  Fly   187 MNIDRQPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKG 251
            ..:.....|.|...:|..:|...:|||.:.:..|..|||.|.:                      
Zfish   176 AALPLLTNEDCKRFWGNKITDLMVCAGASGASSCMGDSGGPLV---------------------- 218

  Fly   252 QCQNSGILMDLLSYADWIKRVVRQYGPSTDMN-RSLKKWVDK 292
             ||..|: ..|:....|...|.....|..... ..|:.|||:
Zfish   219 -CQKDGV-WTLVGIVSWGSSVCSTSSPGVYARVTKLRAWVDQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 62/233 (27%)
Tryp_SPc 48..269 CDD:214473 61/230 (27%)
LOC562139NP_001075159.1 Tryp_SPc 33..256 CDD:214473 67/277 (24%)
Tryp_SPc 34..259 CDD:238113 70/280 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.