DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and ctrb.3

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:291 Identity:83/291 - (28%)
Similarity:120/291 - (41%) Gaps:72/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VQGFQMLLEEDCGIPHNISERSVNAKLAQNPWMAYLETPKGFH-CSGTLINHLFVLTAAHCVPDD 81
            |.|:..::..:..:||:.            ||...|:...||| |.|:|||..:|:|||||    
Zfish    28 VSGYARIVNGEEAVPHSW------------PWQVSLQDFTGFHFCGGSLINEFWVVTAAHC---- 76

  Fly    82 LLITVR------LGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRV 140
               :||      |||:| |.|.:     .||..|...|...|.|..||:|...|||.:::|....
Zfish    77 ---SVRTSHRVILGEHN-KGKSN-----TQEDIQTMKVSKVFTHPQYNSNTIENDIALVKLTAPA 132

  Fly   141 EYLNHIRPICIF-ASNRFQEPIDQLTWFTTTVWRETAANA--TSKVLRTMNIDRQPKETCSEIYG 202
            ....|:.|:|:. ||:.|...:.    ..|:.|..|..||  |...|:.:.:.....|.|...:|
Zfish   133 SLNAHVSPVCLAEASDNFASGMT----CVTSGWGVTRYNALFTPDELQQVALPLLSNEDCKNHWG 193

  Fly   203 WNMTFEQICAGNTLSQLCSTDSGAP---QIRKMWHNGSDRYVQLGIASRVKGQCQNS--GILMDL 262
            .|:....||||...:..|..|||.|   |...:|       ..:||.|....:|..:  |:    
Zfish   194 SNIRDTMICAGAAGASSCMGDSGGPLVCQKDNIW-------TLVGIVSWGSSRCDPTMPGV---- 247

  Fly   263 LSYADWIKRVVRQYGPSTDMNRSLKKWVDKI 293
                         ||..|:    |:.|||:|
Zfish   248 -------------YGRVTE----LRDWVDQI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 71/238 (30%)
Tryp_SPc 48..269 CDD:214473 71/235 (30%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 77/281 (27%)
Tryp_SPc 34..261 CDD:238113 80/283 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.