DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and f2

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001015797.1 Gene:f2 / 548514 XenbaseID:XB-GENE-481539 Length:607 Species:Xenopus tropicalis


Alignment Length:308 Identity:73/308 - (23%)
Similarity:124/308 - (40%) Gaps:76/308 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EEDCGIPHNISERSV---------------------NAKLAQNPW--MAYLETPKGFHCSGTLIN 67
            |..||:.....::||                     .|:....||  |.:.::|:...|..:|::
 Frog   319 EAVCGLRPLFEQKSVEDKGEKELLESYMQGRIVKGETAEPGSAPWQVMLFKKSPQELLCGASLLS 383

  Fly    68 HLFVLTAAHCV----------PDDLLITVRLGEYNTKTKVD-CDNHLCQEPFQEYNVDMGFRHRY 121
            ..:||:||||:          .||:|  ||:|:: .:||.: ....:.|       ::....|..
 Frog   384 DRWVLSAAHCIFYPPWDKNYTTDDIL--VRIGKH-FRTKYERATERIAQ-------LERIIVHPK 438

  Fly   122 YNANDQTN-DIGMLRLGRRVEYLNHIRPICIFASNRFQEPID-------------QLTWFTTTVW 172
            ||..:..: ||.:::|.|.|.:.|:|.|:|:...:...:.:.             |.||      
 Frog   439 YNWKENLDRDIALIQLKRPVAFSNYIHPVCLPTKDTVVKLLAAGYKGRVTGWGNLQETW------ 497

  Fly   173 RETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAG-----NTLSQLCSTDSGAPQIRKM 232
             .:.|....:.|:.:|:....:|||.......:|....|||     :.....|..|||.|.:.|.
 Frog   498 -TSGAQNLPQALQQINLPIVDQETCKSSTNIKVTDNMFCAGYNPEDSKRGDACEGDSGGPFVMKD 561

  Fly   233 WHNGSDRYVQLGIASRVKGQCQNS---GILMDLLSYADWIKRVVRQYG 277
            ...|  |:|||||.|..:| |...   |..:.:.....||.:.|.::|
 Frog   562 PDTG--RWVQLGIVSWGEG-CDRDNKYGFYVHVHRMRKWIMKTVEKFG 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 65/258 (25%)
Tryp_SPc 48..269 CDD:214473 63/255 (25%)
f2NP_001015797.1 GLA 23..86 CDD:214503
KR 106..185 CDD:214527
KR 206..287 CDD:214527
Thrombin_light 303..349 CDD:370463 5/29 (17%)
Tryp_SPc 349..598 CDD:214473 64/268 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.