DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and C1s1

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001091086.1 Gene:C1s1 / 50908 MGIID:1355312 Length:694 Species:Mus musculus


Alignment Length:281 Identity:69/281 - (24%)
Similarity:108/281 - (38%) Gaps:45/281 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGI---PHNISERSVN---AKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHC---VPDDLLI 84
            ||:   |..:.:|...   ||:...||..:...|:   .||.|||..:||||||.   :.|.|:.
Mouse   431 CGVPTEPFQVHQRIFGGQPAKIENFPWQVFFNHPR---ASGALINEYWVLTAAHVLEKISDPLMY 492

  Fly    85 TVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQ-------TNDIGMLRLGRRVEY 142
               :|..:.:|.:       .|..|.......|.|..:...|.       .|||.:::|...|:.
Mouse   493 ---VGTMSVRTTL-------LENAQRLYSKRVFIHPSWKKEDDPNTRTNFDNDIALVQLKDPVKM 547

  Fly   143 LNHIRPICI--FASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWN- 204
            ...:.|||:  .:|.....|.|.   ...:.|..|........||...:.....|||.::...| 
Mouse   548 GPKVSPICLPGTSSEYNVSPGDM---GLISGWGSTEKKVFVINLRGAKVPVTSLETCKQVKEENP 609

  Fly   205 --------MTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSGILMD 261
                    .|...||||......|..|||.....::.:....::...|:.|..| :|...|:...
Mouse   610 TVRPEDYVFTDNMICAGEKGVDSCHGDSGGAFAFQVPNVTVPKFYVAGLVSWGK-RCGTYGVYTK 673

  Fly   262 LLSYADWIKRVVRQ-YGPSTD 281
            :.:|.|||.:.::: .||..|
Mouse   674 VKNYVDWILKTMQENSGPRKD 694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 60/244 (25%)
Tryp_SPc 48..269 CDD:214473 58/241 (24%)
C1s1NP_001091086.1 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:373209
CUB 181..293 CDD:366096
CCP 307..361 CDD:153056
CCP 365..428 CDD:153056
Tryp_SPc 443..681 CDD:214473 61/254 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.