DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Prss33

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:278 Identity:66/278 - (23%)
Similarity:106/278 - (38%) Gaps:66/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPHNISERSVNAKLAQN---PWMAYLETPKGFH-CSGTLINHLFVLTAAHCVPDDLL---ITV 86
            ||.| .:|.|.|..:.||:   ||...:: .:|.| |.|:||...:||||.||....:|   .:|
  Rat    25 CGQP-RMSSRIVGGRDAQDGEWPWQTSIQ-HRGAHVCGGSLIAPQWVLTAGHCFSRRVLPSEYSV 87

  Fly    87 RLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRY------------YNANDQTNDIGMLRLGRR 139
            .||                    ..::|:...|..            |:.::...|:.:|:|...
  Rat    88 LLG--------------------ALSLDVTSSHELLVPVLRVLLPPDYSEDEARGDLALLQLSHP 132

  Fly   140 VEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANA---TSKVLRTMNIDRQPKETCSEIY 201
            |.....|:|:|:.|......| ....|  .|.|...:...   ..:.|:.:.:.......|..:|
  Rat   133 VSLSARIQPVCLPAPGSHPPP-GSPCW--VTGWGSLSPGVPLPKGRPLQGVRVPLLDSRACDRLY 194

  Fly   202 --GWNMTFEQ-------ICAG--NTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQC-- 253
              |.|:...:       :|||  ......|..|||.|    :....|.|:|.:|:.|..|| |  
  Rat   195 HMGANVPKSERIVLPGNLCAGYRRGHKDACQGDSGGP----LTCMESGRWVLVGVVSWGKG-CAL 254

  Fly   254 -QNSGILMDLLSYADWIK 270
             ...|:..::..|:.||:
  Rat   255 PNRPGVYTNVAKYSPWIQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 58/256 (23%)
Tryp_SPc 48..269 CDD:214473 56/253 (22%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 60/266 (23%)
Tryp_SPc 34..272 CDD:238113 60/266 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.