DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and prss27

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_031749235.1 Gene:prss27 / 496619 XenbaseID:XB-GENE-5744470 Length:724 Species:Xenopus tropicalis


Alignment Length:273 Identity:74/273 - (27%)
Similarity:113/273 - (41%) Gaps:56/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DCGIPHNISERSVNAKLAQN---PWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDD---LLITV 86
            ||||| .:|.|.:..:.||.   ||........|..|.||||:..:|::||||.|..   ..:|.
 Frog    24 DCGIP-LVSSRIMGGQSAQEGQWPWQVSFRNNGGHFCGGTLISKQYVISAAHCFPSSSSASSVTA 87

  Fly    87 RLGEYNTKTKVD-CDNHLCQEPFQ---EYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIR 147
            .||.|    .:| .|.:....|.|   .|       ..|.|..| :.||.:::|...|.:.|:|.
 Frog    88 VLGAY----MIDQPDGNQVAIPVQSATNY-------PSYVNEGD-SGDISLVQLASPVTFTNYIL 140

  Fly   148 PICIFASNRFQEPIDQLTWFT-----TTVWRETAAN---ATSKVLRTMNIDRQPKETCSEIYGWN 204
            |:|:        |.|.:|:.|     .|.|...|::   .:...|:.:.:.......|:.:|...
 Frog   141 PVCL--------PADTVTFPTGLQCWVTGWGNIASDVSLVSPMTLQEVAVPLIDANECNALYQTP 197

  Fly   205 MTF---------EQICAG--NTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVK--GQCQNS 256
            .::         :.||||  |.....|..|||.|.:    .:.|.::...|:.|..:  ||....
 Frog   198 NSYGTSSISVHSDMICAGFINGGKDSCQGDSGGPLV----CSSSGQWFLAGVVSFGEGCGQAYRP 258

  Fly   257 GILMDLLSYADWI 269
            |:...:.||.|||
 Frog   259 GVYTLMPSYTDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 65/250 (26%)
Tryp_SPc 48..269 CDD:214473 63/248 (25%)
prss27XP_031749235.1 Tryp_SPc 34..271 CDD:238113 65/260 (25%)
Tryp_SPc 420..659 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.