DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and tmprss2

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001008623.1 Gene:tmprss2 / 494080 ZFINID:ZDB-GENE-041212-48 Length:486 Species:Danio rerio


Alignment Length:270 Identity:68/270 - (25%)
Similarity:105/270 - (38%) Gaps:47/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DCGIPHNISERSVNAKLAQN----PWMAYLETPKGFHCSGTLINHLFVLTAAHCV-----PDDLL 83
            |||  .:...|.|......:    ||...|.......|.|::|...::|||||||     |... 
Zfish   243 DCG--RSTGNRIVGGTTVTSKGVWPWQVSLHYSGRHLCGGSIITPYWILTAAHCVHQFSNPGGW- 304

  Fly    84 ITVRLGEYNTKTKV-----DCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYL 143
             ||..| |.|::::     :..|.:....|              |.|...|||.::||...:...
Zfish   305 -TVYAG-YLTQSEMASASGNSVNRIVIHDF--------------NPNTNENDIALMRLNTALTIS 353

  Fly   144 NHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSE--IYGWNMT 206
            .:|||:|:  .|:......|...:.|......:..::|..|:...|.......|:.  :|...:|
Zfish   354 TNIRPVCL--PNKGMSFTAQQDCYVTGWGALFSGGSSSATLQEAKIQLIDSTICNSRPVYNGLIT 416

  Fly   207 FEQICAGNTLSQL--CSTDSGAP---QIRKMWHNGSDRYVQLGIASRVKGQCQNSGILMDLLSYA 266
            ...||||.....:  |..|||.|   .:|.:|....|.....|.|.|.|     .|:..::..:.
Zfish   417 DTMICAGKLAGGVDSCQGDSGGPLVTNVRSLWWLLGDTSWGDGCAVRNK-----PGVYGNVTYFL 476

  Fly   267 DWIKRVVRQY 276
            |||.:.:|:|
Zfish   477 DWIYQQMRKY 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 61/240 (25%)
Tryp_SPc 48..269 CDD:214473 59/237 (25%)
tmprss2NP_001008623.1 LDLa 132..168 CDD:238060
SRCR_2 173..248 CDD:295335 3/6 (50%)
Tryp_SPc 251..479 CDD:214473 61/251 (24%)
Tryp_SPc 252..482 CDD:238113 62/253 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.