DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and deltaTry

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster


Alignment Length:283 Identity:64/283 - (22%)
Similarity:114/283 - (40%) Gaps:48/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNFIIGI-AVICCLWRRVQGFQMLLEEDCGIPHNISERSVNAK---LAQNPWMAYLETPKGFHC 61
            |..|:|.: ||.|.|...|..         |:...:..|.|...   ::..||...|:......|
  Fly     1 MLKFVILLSAVACALGGTVPE---------GLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSC 56

  Fly    62 SGTLINHLFVLTAAHCVP--DDLLITVRLG-EYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYN 123
            .|::.:...::|||||:.  ...::.:|.| .|.:...|            .::|.....|..||
  Fly    57 GGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGV------------TFSVSSFKNHEGYN 109

  Fly   124 ANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLT-WFTTTVWRETAANATSKVLRTM 187
            ||...|||.::::...:.:.:.|:.|.:.:||........:: |.|.:.    .:::....|:.:
  Fly   110 ANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSY----GSSSIPSQLQYV 170

  Fly   188 NIDRQPKETC-SEIYGWNMTFE--QICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRV 249
            |::...:..| |..||:.....  .|||..:....|..|||.|.:     :|.   |.:|:.|..
  Fly   171 NVNIVSQSQCASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLV-----SGG---VLVGVVSWG 227

  Fly   250 KGQCQNS---GILMDLLSYADWI 269
            .| |..|   |:..|:.:...|:
  Fly   228 YG-CAYSNYPGVYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 53/232 (23%)
Tryp_SPc 48..269 CDD:214473 52/230 (23%)
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 54/243 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.