DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP012504

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_001231011.2 Gene:AgaP_AGAP012504 / 4578496 VectorBaseID:AGAP012504 Length:839 Species:Anopheles gambiae


Alignment Length:263 Identity:63/263 - (23%)
Similarity:105/263 - (39%) Gaps:40/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CSGTLINHLFVLTAAHCVPDDLLI---TVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYY 122
            |.|:||...|:||||||..||..:   ..|:|:.|..:..|      .|..|:..:....||..:
Mosquito    49 CGGSLIWENFILTAAHCAADDDNVPPDVARMGDINIYSDED------DEFAQQLKIVEIIRHPKH 107

  Fly   123 NANDQTNDIGMLRLGRRVEYLNHIRPICIFASN--RFQEPIDQLTWFTTTVWRETAANA-TSKVL 184
            ..|....||.:::|.|.|...:.:.|.|::..:  ||.|       .....|..|..:. |:|.|
Mosquito   108 KYNSNYYDIALMKLERNVTLHDTVAPSCLWLDDEIRFPE-------LLAAGWGRTGFDQNTTKTL 165

  Fly   185 RTMNIDRQPKETCSEIYGW-------NMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQ 242
            ..:.:.....:.||..|..       .:...|.|||:.....|..|||.|...|::.........
Mosquito   166 LKVQLAPITNDKCSTHYQRGVRKLENGLMDHQFCAGDEKMDTCPGDSGGPLHVKLFKEWKLIPFL 230

  Fly   243 LGIASRVKGQC--QNSGILMDLLSYADWIKRVVRQYGP-----------STDMNRSLKKWVDKIP 294
            :|:.|..|. |  ...|:.:.:..:.|||...::::|.           .||...:|:::.:.:.
Mosquito   231 VGVTSFGKA-CGLAAPGVYVKVSKFGDWIIETLQRHGEMATRFKFEPLVCTDRYYNLREYKEDLV 294

  Fly   295 VFY 297
            ..|
Mosquito   295 RVY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 58/225 (26%)
Tryp_SPc 48..269 CDD:214473 56/222 (25%)
AgaP_AGAP012504XP_001231011.2 Tryp_SPc 22..261 CDD:238113 58/225 (26%)
Tryp_SPc 22..258 CDD:214473 56/222 (25%)
Trypsin 327..528 CDD:278516
Tryp_SPc 333..>433 CDD:304450
Tryp_SPc 611..836 CDD:304450
Tryp_SPc 611..832 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.