DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP009219

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_001238240.1 Gene:AgaP_AGAP009219 / 4578286 VectorBaseID:AGAP009219 Length:120 Species:Anopheles gambiae


Alignment Length:64 Identity:21/64 - (32%)
Similarity:29/64 - (45%) Gaps:13/64 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 SQLCSTDSGAPQ--------IRKMWHNGSDRYVQLGIASRVKGQC--QNS-GILMDLLSYADWI 269
            ||:|:..||...        :..:..||  |:||.||||.....|  .|| .:...:.|:.|||
Mosquito    53 SQICAFQSGGSDNCENSLGPLTALGRNG--RHVQYGIASYGVNNCDLDNSPSVYTRVESFIDWI 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 21/64 (33%)
Tryp_SPc 48..269 CDD:214473 19/62 (31%)
AgaP_AGAP009219XP_001238240.1 Tryp_SPc <41..117 CDD:304450 21/64 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.