DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CLIPE7

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_001238368.1 Gene:CLIPE7 / 4577639 VectorBaseID:AGAP011786 Length:433 Species:Anopheles gambiae


Alignment Length:276 Identity:70/276 - (25%)
Similarity:108/276 - (39%) Gaps:59/276 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EEDCGIPHNISERSVNAKLAQNPWMAYL----ETPKGFH--CSGTLINHLFVLTAAHCV---PDD 81
            ||.||   ..::..:.......||:..:    ..|..|.  |..:||....||||..||   |.:
Mosquito   173 EESCG---TRNDHGIGFDATHFPWLVSVFHEEHAPDSFSLICGASLITPHAVLTAGRCVFNMPKE 234

  Fly    82 LLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHI 146
            .|: :|.||:.::     |..|.|  :||..|.....:..||....:|::.:|.|....:...::
Mosquito   235 KLL-LRAGEWTSQ-----DKELRQ--YQERRVADIMTYEEYNDRTFSNNVALLNLTEPFQRTGNV 291

  Fly   147 RPIC---IFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTF- 207
            :|||   |.||      ||....| |..:.|..:.....|...:|:...|.          |.| 
Mosquito   292 QPICLPPIPAS------IDAYRCF-TVAFDEHLSYKYGSVQLNVNMAHIPV----------MLFG 339

  Fly   208 ----------EQICA-GNTLSQLCSTDSGAPQIRKMWHNGS-DRYVQLGIASRVKGQCQNSG--- 257
                      ..:|| ||....:|...:|.|.:..|  .|| :.|.|.||.|...| |...|   
Mosquito   340 FCRHSGPGPSSYLCARGNLGPNVCRAITGTPLVCPM--PGSPNHYYQAGIVSWGVG-CDTYGVPS 401

  Fly   258 ILMDLLSYADWIKRVV 273
            :..::.|:..||::.:
Mosquito   402 VYGNVASFRYWIEQAL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 66/251 (26%)
Tryp_SPc 48..269 CDD:214473 64/248 (26%)
CLIPE7XP_001238368.1 Tryp_SPc 185..415 CDD:238113 66/257 (26%)
Tryp_SPc 185..413 CDD:214473 64/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.