DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP011040

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_001237041.2 Gene:AgaP_AGAP011040 / 4577547 VectorBaseID:AGAP011040 Length:284 Species:Anopheles gambiae


Alignment Length:294 Identity:77/294 - (26%)
Similarity:116/294 - (39%) Gaps:67/294 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DCGIPH--------------NISERSVNAKLAQNPWMAYLETPKG---FHCSGTLINHLFVLTAA 75
            ||.|.:              :||.|..:...|...|:    ..||   |.|.|:||...||||||
Mosquito     3 DCKIRYYADISVGFSAPSLGHISMRLEHTHAAAIGWL----NEKGKIEFGCGGSLILESFVLTAA 63

  Fly    76 HCV--PDDL--LITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFR----HRYYNANDQTNDIG 132
            ||:  |:.|  .:.||||          |.:|......||..::..|    |..||......||.
Mosquito    64 HCMDNPNTLERPLVVRLG----------DRNLIHSKDSEYAQEIKIRDIIPHPKYNRATSHFDIA 118

  Fly   133 MLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSK---------VLRTMN 188
            :|.|.:....:..:.|.|::..       |:|. |:|.......||...|         ||:.:.
Mosquito   119 LLVLDKPARRVFGVIPACLWLE-------DELL-FSTLYAAGWGANGFDKKPTNYLVTAVLQPVT 175

  Fly   189 ----IDRQPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQ--LGIAS 247
                ||:..::.........::..|:||.......|..|||.|...|:  |.:::.|.  :|:.|
Mosquito   176 NEECIDKLKRQVPRMKLANGISDHQLCAAGIEMDTCKGDSGGPLYSKL--NFANKLVPFLVGLTS 238

  Fly   248 RVKGQC--QNSGILMDLLSYADWIKRVVRQYGPS 279
             ..|.|  ...|:.:.:..:.|||...:||:.||
Mosquito   239 -YGGPCGFSQPGVYVRVSKFRDWIIETIRQFNPS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 66/251 (26%)
Tryp_SPc 48..269 CDD:214473 64/248 (26%)
AgaP_AGAP011040XP_001237041.2 Tryp_SPc 49..264 CDD:238113 62/235 (26%)
Tryp_SPc 49..261 CDD:214473 60/232 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.