DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CLIPB19

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_001237510.1 Gene:CLIPB19 / 4577378 VectorBaseID:AGAP003247 Length:367 Species:Anopheles gambiae


Alignment Length:275 Identity:77/275 - (28%)
Similarity:130/275 - (47%) Gaps:41/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPHNISERSVNAKLAQ---NPWMAYLETPK-----GFHCSGTLINHLFVLTAAHCV---PDDL 82
            ||:..|  .|.:.::..|   .||.|.:|..|     ||||.|||||...:|||||||   |...
Mosquito   106 CGVRTN--TRLIGSQFTQLDDYPWTALIEYEKPDGSTGFHCGGTLINQGHILTAAHCVSTLPAGW 168

  Fly    83 LI-TVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNA--NDQTNDIGMLRLGRRVEYLN 144
            .: .|||||::....:||:.:.|.....:..:.....|..|:|  ...::||.::|..::|.:.:
Mosquito   169 KVHGVRLGEWDLSEALDCELNYCNNAPVDLKISKIMIHEGYDALNGSSSHDIALIRFEQQVNFSD 233

  Fly   145 HIRPIC--IFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIY--GWNM 205
            .|:|||  :..|.|.:...|.::  |...|.::.::|.......:|::.:....||.::  ...:
Mosquito   234 TIKPICLPLAESIRSKNMTDGIS--TVVGWGKSQSSAGVPKRLKLNLNVRDYRVCSALFVRPEEV 296

  Fly   206 TFEQICA--GNTLSQLCSTDSGAPQIRKMWHNGSDRYVQ-----LGIASRVKGQCQNS---GILM 260
            ...|:||  ..:.::|||.||||         |.:|:..     .|||...:.:|...   |:.:
Mosquito   297 QPSQLCALREESNNELCSADSGA---------GLERFFYGFQYLTGIAGSGEHKCGRGNIPGLFV 352

  Fly   261 DLLSYADWIKRVVRQ 275
            .:..|.:||:..||:
Mosquito   353 SVADYVEWIQEKVRE 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 70/248 (28%)
Tryp_SPc 48..269 CDD:214473 68/245 (28%)
CLIPB19XP_001237510.1 CLIP 36..89 CDD:288855
Tryp_SPc 113..361 CDD:214473 70/258 (27%)
Tryp_SPc 115..364 CDD:238113 71/259 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.