DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP004571

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_313875.2 Gene:AgaP_AGAP004571 / 4576898 VectorBaseID:AGAP004571 Length:324 Species:Anopheles gambiae


Alignment Length:272 Identity:79/272 - (29%)
Similarity:108/272 - (39%) Gaps:62/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPHNISERSVNAK---LAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDL--LITVRL 88
            || ..|.:.|.|..:   :.:.||||.|.....|:|.|.|||..:||||||||...:  :|.|..
Mosquito    74 CG-ERNDASRIVGGQATGVNEFPWMARLSYFNRFYCGGMLINDRYVLTAAHCVKGFMWFMIKVTF 137

  Fly    89 GEYNTKTKVDCDNHLCQE----------PFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYL 143
            ||:|.     ||:.:..|          .|...|.|              |||.:|||..||...
Mosquito   138 GEHNR-----CDDSVRPETRFVLRAIAQKFSFLNFD--------------NDIALLRLNDRVPIT 183

  Fly   144 NHIRPICIFASNRFQEPIDQLTWF-----TTTVWRETAANA-TSKVLRTMNIDRQPKETCSEIYG 202
            :.|||||:        |.|....:     |.|.|.....:. .|.:|:.:.:.....|.||....
Mosquito   184 DFIRPICL--------PSDPSNAYVGTNGTATGWGTLKEDGKPSCILQEVEVPVLSNEVCSTQTN 240

  Fly   203 WN---MTFEQICAGNT---LSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQN---SGI 258
            :.   :|...:|||..   ....|..|||.|.|.:   ....||..:|:.|...| |..   .|:
Mosquito   241 YTASMITDNMLCAGYLGVGEKDSCQGDSGGPLIAE---REDKRYELIGVVSWGNG-CARPYYPGV 301

  Fly   259 LMDLLSYADWIK 270
            ...:..|.|||:
Mosquito   302 YTRVTRYLDWIR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 74/250 (30%)
Tryp_SPc 48..269 CDD:214473 72/247 (29%)
AgaP_AGAP004571XP_313875.2 Tryp_SPc 82..312 CDD:214473 74/260 (28%)
Tryp_SPc 83..315 CDD:238113 75/262 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.