DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP006710

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_565496.1 Gene:AgaP_AGAP006710 / 4576607 VectorBaseID:AGAP006710 Length:258 Species:Anopheles gambiae


Alignment Length:211 Identity:58/211 - (27%)
Similarity:96/211 - (45%) Gaps:44/211 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RSVNAKLAQN---PWMAYLETPK-GFHCSGTLINHLFVLTAAHCV----PDDLLITVRLGEYNTK 94
            |.|..::|:|   |:...|:.|. |.:|.|:|:|:.:|||||||:    |.||::.|  |..:.|
Mosquito    32 RVVGGEVAKNGSAPYQVSLQVPGWGHNCGGSLLNNRWVLTAAHCLVGYEPSDLMVLV--GTNSLK 94

  Fly    95 TKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQE 159
                       |..:...||....|..||.....||||::||.:.|::...::.:         |
Mosquito    95 -----------EGGELLKVDKLLYHSRYNRPQFHNDIGLMRLEQPVQFSELVQSV---------E 139

  Fly   160 PIDQLTWFTTTV----WRETAANA-TSKVLRTMNIDRQPKETCSEIYG--WNMTFEQICAGNTLS 217
            .:::......||    |..|:.|. ...:|:::|:.....|.|....|  .|:....:|   ||:
Mosquito   140 YLEKAVPVNATVRLTGWGRTSTNGNVPTLLQSLNVVTLSNEDCKAKMGNPENVDLGHVC---TLT 201

  Fly   218 Q----LCSTDSGAPQI 229
            :    .|:.|||.|.:
Mosquito   202 KAGEGACNGDSGGPLV 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 54/198 (27%)
Tryp_SPc 48..269 CDD:214473 54/198 (27%)
AgaP_AGAP006710XP_565496.1 Tryp_SPc 32..250 CDD:214473 58/211 (27%)
Tryp_SPc 33..253 CDD:238113 57/210 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.