powered by:
Protein Alignment CG33462 and pafah1b3
DIOPT Version :9
Sequence 1: | NP_995844.2 |
Gene: | CG33462 / 2768841 |
FlyBaseID: | FBgn0053462 |
Length: | 300 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001006715.1 |
Gene: | pafah1b3 / 448360 |
XenbaseID: | XB-GENE-485956 |
Length: | 226 |
Species: | Xenopus tropicalis |
Alignment Length: | 71 |
Identity: | 18/71 - (25%) |
Similarity: | 32/71 - (45%) |
Gaps: | 10/71 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 IAVICCLWRR---VQGFQMLLEEDCGIPHNISERS--VNAKLAQN----PWMAYLETPKGF-HCS 62
:|::.|:::| .:...|.|......|:.:..|: ||..|.:. |....|:...|| |..
Frog 119 LAIVRCIYQRQPQAKVIVMALLPRGKNPNPLRNRNLQVNKLLEETLPSLPNAFLLDADPGFVHSD 183
Fly 63 GTLINH 68
||:.:|
Frog 184 GTISHH 189
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.