DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and ctrl

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:276 Identity:76/276 - (27%)
Similarity:117/276 - (42%) Gaps:46/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIP--------HNISERSVNAKLAQNPWMAYLETPKGFH-CSGTLINHLFVLTAAHCVPDDLLI 84
            ||:|        :|......||.....||...|:...||| |.|:|||..:|:|||||.......
Zfish    17 CGVPAIKPVISGYNRIVNGENAVSGSWPWQVSLQQSNGFHFCGGSLINQYWVVTAAHCRVQAGYH 81

  Fly    85 TVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPI 149
            .|.|||:        |.....|..|..::.....|.|||:.:..|||.:|:|....:..:.|.|:
Zfish    82 YVILGEH--------DRGSSAESVQVKSIAKAITHPYYNSQNFNNDITLLKLSSPAQLTSRISPV 138

  Fly   150 CIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWN-MTFEQICAG 213
            |:.||:   ..|...|...||.|.:|.:.::.::|:...:.......|.:.:|.| :|...||||
Zfish   139 CLAASS---TSIPSGTRCVTTGWGKTGSTSSPRILQQTALPLLSPAQCKQYWGQNRITDAMICAG 200

  Fly   214 NTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQ-NSGILMDLLSYADWIKRVVRQYG 277
            .:....|..|||.|.:.:    .|..:.|:||.|.....|. .:..:...:||            
Zfish   201 ASGVSSCQGDSGGPLVCE----SSGAWYQVGIVSWGTSDCNVRTPAVYARVSY------------ 249

  Fly   278 PSTDMNRSLKKWVDKI 293
                    |::|:|:|
Zfish   250 --------LRQWIDQI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 66/226 (29%)
Tryp_SPc 48..269 CDD:214473 66/223 (30%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 69/257 (27%)
Tryp_SPc 32..257 CDD:238113 71/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.