DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP012777

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_001230468.2 Gene:AgaP_AGAP012777 / 4397664 VectorBaseID:AGAP012777 Length:465 Species:Anopheles gambiae


Alignment Length:200 Identity:44/200 - (22%)
Similarity:83/200 - (41%) Gaps:17/200 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 QEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWR 173
            ||:.|.....|..||::...|||.:::|...:.....::|:|::..::.||.|...|. |...:.
Mosquito     9 QEHTVQELIVHPGYNSSRFVNDIALIKLTESITMSEFVQPVCLWTMDKNQELIVGKTG-TLVGFG 72

  Fly   174 ETAANATSKVLRTMNIDRQPKETCSE----IYGWNMTFEQICAGNTLS-QLCSTDSGAPQIRKMW 233
            ....:..|:.|:..:|......||.:    .:...:|.|..|.|...: ..|:.|||.    .::
Mosquito    73 LNEQDVVSEQLKQASIGVVDALTCIKSDRLSFANQLTAEMFCGGGQSNVSACNGDSGG----GLF 133

  Fly   234 HNGSDRYVQLGIASRV-----KGQCQNS--GILMDLLSYADWIKRVVRQYGPSTDMNRSLKKWVD 291
            .|...::...|:.|.:     .|.|..|  ....|:..|..||.:.:.:.....|.:.....:.:
Mosquito   134 FNVEGKWFVRGVVSFIPVRQRTGLCDPSKYTAYADVAKYLGWIDQYIDRRVLVFDTDELEVDYEE 198

  Fly   292 KIPVF 296
            |:|:|
Mosquito   199 KLPLF 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 40/174 (23%)
Tryp_SPc 48..269 CDD:214473 38/171 (22%)
AgaP_AGAP012777XP_001230468.2 Tryp_SPc <1..178 CDD:238113 40/173 (23%)
Tryp_SPc <4..176 CDD:214473 38/171 (22%)
Tryp_SPc 219..458 CDD:214473
Tryp_SPc 219..458 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.