DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and zgc:92313

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001002596.1 Gene:zgc:92313 / 436869 ZFINID:ZDB-GENE-040718-339 Length:309 Species:Danio rerio


Alignment Length:305 Identity:76/305 - (24%)
Similarity:121/305 - (39%) Gaps:70/305 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EDCGIPHNISERSVNAKLAQN---PWMAYLETPKGFH-CSGTLINHLFVLTAAHCVPDDLLITVR 87
            ::||.|..|: |.|....|.:   ||...::..|..| |.||:|:..:||:||||.|:       
Zfish    24 QECGRPPMIN-RIVGGSSAADGAWPWQVDIQGEKSKHVCGGTIISENWVLSAAHCFPN------- 80

  Fly    88 LGEYNTKTKVDCDNHLCQEPFQEYNVDMGFR-----HRY--------YNANDQTNDIGMLRLGRR 139
                    ..|...:|.....|:.|   |:.     ||.        |.......||.::.|...
Zfish    81 --------PNDISGYLIYAGRQQLN---GWNPDETSHRISRVVVPLGYTDPQLGQDIALVELATP 134

  Fly   140 VEYLNHIRPICI-FASNRFQEPIDQLTWFTTTVW---RETAANATSKVLRTMNIDRQPKETCSEI 200
            ..|...|:|:|: :|:..|...:..:    .|.|   ||..|......|:.:.:.....:.|.::
Zfish   135 FVYTERIQPVCLPYANVEFTSDMRCM----ITGWGDIREGVALQGVGPLQEVQVPIIDSQICQDM 195

  Fly   201 YGWNMTF------EQICAG--NTLSQLCSTDSGAP---QIRKMWHNGSDRYVQLGIASRVKG--Q 252
            :..|.|.      :.:|||  ......|..|||.|   ||    .:||  :||.||.|...|  :
Zfish   196 FLTNPTENIDIRPDMMCAGFQQGGKDSCQGDSGGPLACQI----SDGS--WVQAGIVSFGLGCAE 254

  Fly   253 CQNSGILMDLLSYADWIKRVVR--QYGPSTDMNRSLKKWVDKIPV 295
            ....|:...:.|:.::|:..|.  |...|::.|     |.|::.|
Zfish   255 ANRPGVYAKVSSFTNFIQTHVGGIQLKSSSNHN-----WADRVLV 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 62/254 (24%)
Tryp_SPc 48..269 CDD:214473 61/251 (24%)
zgc:92313NP_001002596.1 Tryp_SPc 34..271 CDD:214473 64/264 (24%)
Tryp_SPc 35..274 CDD:238113 64/266 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.