DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG11313

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:279 Identity:83/279 - (29%)
Similarity:119/279 - (42%) Gaps:49/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CG--IPHNISERSVNAKLAQNPWMAYLE-TPKG-----FHCSGTLINHLFVLTAAHCVPD----- 80
            ||  |.:|...:.....|.:..||..|| .|..     .:|:|:|||:.:|:||||||..     
  Fly   107 CGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRAR 171

  Fly    81 ----DLLITVRLGEYNTKTKVDCDNHLC-QEPFQ----EYNVDMGFRHRYYNANDQTNDIGMLRL 136
                ...::|||||:||...|||.|..| .||.|    |..:...|..|.:     .|||.::||
  Fly   172 KGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLF-----WNDIALIRL 231

  Fly   137 GRRVEYLNHIRPICIFASNRFQEPIDQLTW-----FTTTVWRETAANATSKVLRTMNIDRQPKET 196
            .|.|.|...|||:|:.::...|      .|     ||...|..|..:.:|.|...:.:.......
  Fly   232 AREVAYSPSIRPVCLPSTVGLQ------NWQSGQAFTVAGWGRTLTSESSPVKMKLRVTYVEPGL 290

  Fly   197 CSEIYGWNMTF--EQICA-GNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQN--- 255
            |...|...:..  ..:|| |.:....|..|||.|.:  .:|.|.  :|..||.| ....|.:   
  Fly   291 CRRKYASIVVLGDSHLCAEGRSRGDSCDGDSGGPLM--AFHEGV--WVLGGIVS-FGLNCGSRFW 350

  Fly   256 SGILMDLLSYADWIKRVVR 274
            ..:..::|||..||.:.:|
  Fly   351 PAVYTNVLSYETWITQNIR 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 77/254 (30%)
Tryp_SPc 48..269 CDD:214473 75/251 (30%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 78/266 (29%)
Tryp_SPc 116..364 CDD:214473 76/263 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.