DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Jon99Fi

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:266 Identity:62/266 - (23%)
Similarity:108/266 - (40%) Gaps:56/266 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IPHNISERSVNAKLAQNPWMAY----------LETPKG-FHCSGTLINHLFVLTAAHCVPDDLLI 84
            :|..:.:..:..::. |.:.||          |.:..| :.|.|::|.:.:|||||||......:
  Fly    25 VPTPVKDVKIQGRIT-NGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGV 88

  Fly    85 TVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMG--FRHRYYNANDQTNDIGMLR--------LGRR 139
            |:..|.           .|..:|...:.|..|  .:|.:||:.:..|||.::|        |..:
  Fly    89 TINYGA-----------SLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTPHVDFWHLVNK 142

  Fly   140 VEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRET-AANATSKVLRTMNIDRQPKETCSEIYGW 203
            ||..::        ::|:|:...  .|...:.|..| ..:.....|:.:::....:..||..  |
  Fly   143 VELPSY--------NDRYQDYAG--WWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRT--W 195

  Fly   204 NMTFEQICAG-NTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQ-CQNS--GILMDLLS 264
            ::....||.. |.....|..|||.|.:.   |.| :|.|  |:.|.|... ||:.  .:...:..
  Fly   196 SLHDNMICINTNGGKSTCGGDSGGPLVT---HEG-NRLV--GVTSFVSSAGCQSGAPAVFSRVTG 254

  Fly   265 YADWIK 270
            |.|||:
  Fly   255 YLDWIR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 60/249 (24%)
Tryp_SPc 48..269 CDD:214473 58/246 (24%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 59/251 (24%)
Tryp_SPc 38..262 CDD:238113 61/253 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435976
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.