DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG9733

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:275 Identity:84/275 - (30%)
Similarity:129/275 - (46%) Gaps:44/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GIPHNI---SERSVNAKLAQNPWMAYLE----TPKGFH--CSGTLINHLFVLTAAHCVPDDL--- 82
            ||.:.|   .:..||    :.|||..||    :..|..  |:|:|||..:|||||||:...:   
  Fly   157 GIRNRIYDGQDTDVN----EFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIERE 217

  Fly    83 ---LITVRLGEYNTKTKVDC--DNHLCQEPFQEYNVDMGFR----HRYYN--ANDQTNDIGMLRL 136
               |::|||||::|:|.|||  ....|....|.    :||.    |..|:  |::|.:|||::|:
  Fly   218 VGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQR----LGFEEIRVHERYSEKASNQVHDIGLIRM 278

  Fly   137 GRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIY 201
            .|.|.|.::|:|||: .|:...|.......||...|..|...|.|.|.:.:.::......|.:.:
  Fly   279 ERNVRYSDNIQPICL-PSSVGLESRQSGQQFTVAGWGRTLKMARSAVKQKVTVNYVDPAKCRQRF 342

  Fly   202 GW---NMTFEQICAGNTL-SQLCSTDSGAPQIR---KMWHNGSDRYVQLGIASRVKGQCQNSGIL 259
            ..   |:...|:|||... ...|..|||.|.:|   :.|  ..:..|..|....:|..   .|:.
  Fly   343 SQIKVNLEPTQLCAGGQFRKDSCDGDSGGPLMRFRDESW--VLEGIVSFGYKCGLKDW---PGVY 402

  Fly   260 MDLLSYADWIKRVVR 274
            .::.:|..||::.||
  Fly   403 TNVAAYDIWIRQNVR 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 77/250 (31%)
Tryp_SPc 48..269 CDD:214473 75/247 (30%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 78/264 (30%)
Tryp_SPc 162..415 CDD:238113 80/266 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.