DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG9737

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:298 Identity:90/298 - (30%)
Similarity:141/298 - (47%) Gaps:44/298 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LWRRVQ------GFQMLLEEDCG--IPHNISERSVNAKLAQNPWMAYL-ETPKGFHCSGTLINHL 69
            |.||:|      ||.:|  .:||  :.:.|....: |:|.:.||:|.| .....:.|||.||:..
  Fly   123 LKRRIQTVEPSSGFNLL--NECGKQVTNRIYGGEI-AELDEFPWLALLVYNSNDYGCSGALIDDR 184

  Fly    70 FVLTAAHCVPDD------LLITVRLGEYNTKTKVDC---DNHL-CQEPFQEYNVDMGFRHRYYN- 123
            .:|||||||..:      .|..|||||:|.||:.||   .|:| |.:...:...:....|..|. 
  Fly   185 HILTAAHCVQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKE 249

  Fly   124 -ANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLT--------WFTTTVWRETAANA 179
             :|.:.|||.::||...|.:.:.:.|||:  .|: .||:....        |..|.::.:...|.
  Fly   250 FSNYKYNDIAIIRLKHPVSFTHFVMPICL--PNK-SEPLTLAEGQMFSVSGWGRTDLFNKYFINI 311

  Fly   180 TSKVLRTMNIDRQPKETCSEI---YGWNMTFEQICAGNTLSQ-LCSTDSGAPQIRKMWHNGSDRY 240
            .|.:...:.|.....|.|::|   :|..:..:|||||...:: .|:.|||.|.:  .:.....|:
  Fly   312 HSPIKLKLRIPYVSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLM--YFDRQHSRW 374

  Fly   241 VQLGIASRVKGQCQNSG---ILMDLLSYADWIKRVVRQ 275
            |..|:.|....||..:|   :..::..|.|||..||:|
  Fly   375 VAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVVQQ 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 75/251 (30%)
Tryp_SPc 48..269 CDD:214473 73/248 (29%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 76/262 (29%)
Tryp_SPc 150..409 CDD:238113 78/264 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.