DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:280 Identity:66/280 - (23%)
Similarity:98/280 - (35%) Gaps:80/280 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DCGIPH-NISERSVNAKLAQNPWMAYL------ETPKGFHCSGTLINHLFVLTAAHCV--PDDLL 83
            |..|.| .|..|..|..||....:.|:      .....:.|.|::|.|.:|||||||.  .|:..
  Fly    29 DLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVLTAAHCTAGADEAS 93

  Fly    84 ITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRH--------RYYNANDQTNDIGMLRLGRRV 140
            :......||             ||        .|||        ||.:.....:|:.:::. ..|
  Fly    94 LYYGAVNYN-------------EP--------AFRHTVSSENFIRYPHYVGLDHDLALIKT-PHV 136

  Fly   141 EYLNHIRPICIFASNRFQEP-ID------QLTWFTTTVWRETAANATSKV---LRTMNIDRQPKE 195
            ::.:.:        |:.:.| :|      :..|.....|  .|....|.|   ||.:::......
  Fly   137 DFYSLV--------NKIELPSLDDRYNSYENNWVQAAGW--GAIYDGSNVVEDLRVVDLKVISVA 191

  Fly   196 TCSEIYGWNMTFEQICAGNTL-------SQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQ- 252
            .|...||.:...|     ||:       ...|..|||.|.:.|    ..|:.:  ||.|.|... 
  Fly   192 ECQAYYGTDTASE-----NTICVETPDGKATCQGDSGGPLVTK----EGDKLI--GITSFVSAYG 245

  Fly   253 CQNSGI--LMDLLSYADWIK 270
            ||..|.  ...:..|.:|||
  Fly   246 CQVGGPAGFTRVTKYLEWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 58/259 (22%)
Tryp_SPc 48..269 CDD:214473 55/256 (21%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 59/266 (22%)
Tryp_SPc 41..266 CDD:238113 61/268 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436141
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.