DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:225 Identity:55/225 - (24%)
Similarity:96/225 - (42%) Gaps:44/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMG--FRHRYYN 123
            |.|::|.:.:|||||||......:|:..|. :.:|          :|...:.|..|  .:|.:||
  Fly    63 CGGSIIGNTWVLTAAHCTNGASGVTINYGA-SIRT----------QPQYTHWVGSGDIIQHHHYN 116

  Fly   124 ANDQTNDIGMLR--------LGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRET-AANA 179
            :.:..|||.::|        |..:||..::        ::|:|:...  .|...:.|..| ..:.
  Fly   117 SGNLHNDISLIRTPHVDFWSLVNKVELPSY--------NDRYQDYAG--WWAVASGWGGTYDGSP 171

  Fly   180 TSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNT--LSQLCSTDSGAPQIRKMWHNGSDRYVQ 242
            ....|:::::....:..||..  |::....||. ||  ....|..|||.|.:.   |:| :|.|.
  Fly   172 LPDWLQSVDVQIISQSDCSRT--WSLHDNMICI-NTDGGKSTCGGDSGGPLVT---HDG-NRLVG 229

  Fly   243 LGIASRVKGQCQNS--GILMDLLSYADWIK 270
            :.......| ||:.  .:...:..|.|||:
  Fly   230 VTSFGSAAG-CQSGAPAVFSRVTGYLDWIR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 55/225 (24%)
Tryp_SPc 48..269 CDD:214473 53/222 (24%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 55/225 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436075
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.