DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG11843

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:262 Identity:69/262 - (26%)
Similarity:108/262 - (41%) Gaps:55/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AKLAQNP-------WMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDL--LITVRLGEYNTKTKV 97
            |:|.:.|       |.          |.|.||:..||||||||:..:.  :..|||||      :
  Fly    83 ARLGRRPDPSSRADWF----------CGGVLISERFVLTAAHCLESERGEVNVVRLGE------L 131

  Fly    98 DCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICI-FASNRFQEPI 161
            |.|:.......::|.|.....|..|......:|||:::|...|.:..:..|.|: |...|..:..
  Fly   132 DFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSSDSF 196

  Fly   162 DQLTWFTTTVWRETAA-----------NATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNT 215
            ..:.|.:|.:..:.:|           |...|.|.|..::..|:       |::.. .|:|.|:.
  Fly   197 IAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPR-------GFDGN-NQLCVGSE 253

  Fly   216 LSQ-LCSTDSGAPQIRKMWHNGSD-RYVQLGIASRVKGQCQNS----GILMDLLSYADWIKRVVR 274
            ::| .|:.|||.|.:  |:|.... .||.:||.|  .|....|    ||...:..|..||.|.:.
  Fly   254 MAQDTCNGDSGGPLL--MYHREYPCMYVVVGITS--AGLSCGSPGIPGIYTRVYPYLGWIARTLA 314

  Fly   275 QY 276
            .:
  Fly   315 TF 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 66/250 (26%)
Tryp_SPc 48..269 CDD:214473 64/247 (26%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 68/256 (27%)
Tryp_SPc 68..309 CDD:214473 66/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437601
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.