DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG11841

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:235 Identity:65/235 - (27%)
Similarity:100/235 - (42%) Gaps:50/235 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CSGTLINHLFVLTAAHCVPDD--LLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYN 123
            |.||||::..|||||||...:  .:..|||||....|  |.|:   .|| :::.|.....|..:.
  Fly   102 CGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDT--DTDD---AEP-EDFGVLALKAHPGFE 160

  Fly   124 ANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPID---QLTWFTTTVW-RETAANATSKVL 184
            .....||||:::|.|.|::..:..|.|:        |.|   |...|....| ::..|...||.|
  Fly   161 NPQLYNDIGIVQLDREVKFNRYKHPACL--------PFDDGEQHESFIAIGWGQKKFAQKESKKL 217

  Fly   185 RTMNIDRQPKETC-------SEIYGWNMTFEQICAGNTLSQ-LCSTDSGAPQIRKMWHNG-SDRY 240
            ..:.:... |:.|       .|:........|:|.|:..:: .|:.|||.|.:  .:|.. :..|
  Fly   218 LKVQLQGY-KDRCVSSVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVL--AYHKDLACMY 279

  Fly   241 VQLGIASRVKGQCQNSGILM---DLLS-------YADWIK 270
            ..:||.|        :||..   |:.|       :.:|||
  Fly   280 HVMGITS--------AGITCSTPDIPSAYTRVHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 65/235 (28%)
Tryp_SPc 48..269 CDD:214473 62/232 (27%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 63/233 (27%)
Tryp_SPc 72..310 CDD:214473 62/232 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437600
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.