DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and grass

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:297 Identity:89/297 - (29%)
Similarity:138/297 - (46%) Gaps:29/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GIAVICCLWRRVQG----FQMLLEE--DCGIPHNISERSVN---AKLAQNPWMAYLETPK----G 58
            |:...||....:|.    ..:..:|  |||  :.:|:|..|   .||:..||||.|...:    .
  Fly    83 GVRHFCCPSANIQHNSKVMSLFKDENFDCG--NFLSQRVSNGYEVKLSSRPWMALLRYQQFGESR 145

  Fly    59 FHCSGTLINHLFVLTAAHCV---PDDLLITVRLGEYNTKTKVDCDNH----LCQEPFQEYNVDMG 116
            |.|.|.:|:..::|||||||   .:| |..:||||:...|:.||...    .|..|.....::..
  Fly   146 FLCGGAMISERYILTAAHCVHGLQND-LYEIRLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKH 209

  Fly   117 FRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATS 181
            ..|..|:|....:||.:|:|.|.|.:..||:|||:..::..:|..:|::.:..|.|..|...::|
  Fly   210 LIHEKYDARHIMHDIALLKLNRSVPFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTENGSSS 274

  Fly   182 KVLRTMNIDRQPKETCSEIYGWNMTFEQIC-AGNTLSQLCSTDSGAPQIRKMWHNG--SDRYVQL 243
            .||...|:..||:..||:.|...:...|:| .|..|...|..|||.|......:.|  :.:.|:.
  Fly   275 DVLLQANVPLQPRSACSQAYRRAVPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEF 339

  Fly   244 GIASR---VKGQCQNSGILMDLLSYADWIKRVVRQYG 277
            ||.|:   ..||....|:..::..|..||...:...|
  Fly   340 GIVSQGVVTCGQISLPGLYTNVGEYVQWITDTMASNG 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 75/240 (31%)
Tryp_SPc 48..269 CDD:214473 73/237 (31%)
grassNP_651543.1 CLIP 32..90 CDD:197829 2/6 (33%)
Tryp_SPc 121..371 CDD:238113 78/250 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.