DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG10232

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:278 Identity:78/278 - (28%)
Similarity:114/278 - (41%) Gaps:46/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPHNISERSVN-------------AKLAQNPWMAY-------LETPKGFHCSGTLINHLFVLT 73
            |..|.|:...|..             |:..:.||||.       |.|... :|||:|||..:|||
  Fly   237 CPEPGNVLPTSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTN-NCSGSLINKRYVLT 300

  Fly    74 AAHCVPDDLLIT-------VRLGEYNTKTKVDCD-NHLCQEPFQEYNVD-MGFRHRYYNANDQTN 129
            |||||..|.::.       |||||::..|..||| ...|..||.|..:: .....:|:|.:...:
  Fly   301 AAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFES 365

  Fly   130 DIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTV----WRETAANATSKVLRTMNID 190
            ||.::||...|.|.:.|.|||:        |.|.:......:    |..|.....|:|| ..|..
  Fly   366 DIALVRLQTPVRYTHEILPICV--------PKDPIPLHNHPLQIAGWGYTKNREYSQVL-LHNTV 421

  Fly   191 RQPKETCSEIYGWNMTFEQICAGNTLSQ-LCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQC- 253
            .:.:..|.:...:.....||||.....: .|..|||.|.:..:.::..|.....||.|.....| 
  Fly   422 YENRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCG 486

  Fly   254 -QNSGILMDLLSYADWIK 270
             :..|:.....::..|||
  Fly   487 DRKPGVYTKTGAFFSWIK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 73/246 (30%)
Tryp_SPc 48..269 CDD:214473 70/243 (29%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 74/255 (29%)
Tryp_SPc 260..503 CDD:214473 71/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463477
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.