DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and SPE

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:336 Identity:90/336 - (26%)
Similarity:140/336 - (41%) Gaps:83/336 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNFIIGIA---VICCLWRRVQGFQM----------LLEEDCGIPHN------ISER---SVNAK 43
            :.|.:.|:.   ::||. :.::|..|          .|::...:|.|      .::|   ..|..
  Fly    79 LDNRVEGLVNRILVCCP-QSMRGNIMDSEPTPSTRDALQQGDVLPGNDVCGFLFADRIFGGTNTT 142

  Fly    44 LAQNPWMAYLETPK------GFHCSGTLINHLFVLTAAHCVPD-------DLLITVRLGEYNTKT 95
            |.:.|||..|:..|      .|:|.|.|:|..:||||.||:..       .:|.:|||||::|:|
  Fly   143 LWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRT 207

  Fly    96 KVDC-----DNHLCQEPFQEYNVDMGFRHRYY--NANDQTNDIGMLRLGRRVEYLNHIRPICI-- 151
            ..||     ...:|.....:..|:.|..|..|  |:.||.|||.::||.|.|.|.:::||||:  
  Fly   208 DPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPT 272

  Fly   152 --FASNRFQE-PIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTF------ 207
              ...|.|.: .:|...|..|    |....:..|:..|:|:             ||:|.      
  Fly   273 DGLVQNNFVDYGMDVAGWGLT----ENMQPSAIKLKITVNV-------------WNLTSCQEKYS 320

  Fly   208 --------EQICAGNTLS-QLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNS---GILM 260
                    .|:|||..|. ..|..|||.|.:..:...|.|.:...|:.|.....|...   |:..
  Fly   321 SFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYT 385

  Fly   261 DLLSYADWIKR 271
            ...::.||||:
  Fly   386 RTGAFIDWIKQ 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 78/267 (29%)
Tryp_SPc 48..269 CDD:214473 75/263 (29%)
SPENP_651168.1 CLIP 42..94 CDD:314844 2/14 (14%)
Tryp_SPc 135..397 CDD:238113 80/279 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463474
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.