DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG31199

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:287 Identity:63/287 - (21%)
Similarity:111/287 - (38%) Gaps:69/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EEDCGI---PHNISERSVNAKLAQNPWMAYLETPKGFH-------CSGTLINHLFVLTAAHC--- 77
            ::.||.   ...::.:|..|...::.|:|.:...|||.       |.|.|::...||..|||   
  Fly    26 DDQCGAFDEDQMLNMQSTFAIPTEHQWVARIVYGKGFEGKIRDNGCLGVLVSKRTVLAPAHCFVQ 90

  Fly    78 ---VPDDLLITVRLGEYNTKTKVD---CD-NHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLR 135
               |.:  ..:|.||.:|....|.   |: :..|..|.||..:.....|..|::....|.:.:|.
  Fly    91 YNGVAE--AFSVHLGVHNKSAPVGVRVCETDGYCVRPSQEIKLAEIAIHPDYDSRTLKNSLAVLT 153

  Fly   136 LGRRVEYLNHIRPICIFASNRFQEPIDQLTW----------FTTTVWRETAAN--ATSKVLRTMN 188
            |.|..:...::.|||:...:...|.:...|:          |....|..|.:.  ..||| :|: 
  Fly   154 LQRDAKIYPNVMPICMPPPSLLNETLVAQTFVVAGLRVFEDFRLKTWVNTLSRGFCQSKV-KTL- 216

  Fly   189 IDRQPKETCSEIYGWNMTFEQICAGNTL----SQLCSTDSGAPQI--RKMWHNGSDRYVQLGIAS 247
                                 :.:.||:    .|..:...|||.:  :|..| .:..|..:||  
  Fly   217 ---------------------VTSSNTVCGYHKQPVAYYLGAPLVGLQKKGH-VTQNYYLVGI-- 257

  Fly   248 RVKGQCQNSGILMDLL---SYADWIKR 271
            .:..:.:|:.|:...|   :|.|:|::
  Fly   258 MIDWRWENNRIMSSFLAIRNYMDFIRQ 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 59/262 (23%)
Tryp_SPc 48..269 CDD:214473 58/258 (22%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 52/237 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.