DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG31219

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:303 Identity:97/303 - (32%)
Similarity:132/303 - (43%) Gaps:62/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ICCLWRRVQGFQMLLEEDCGIPHNISE-RSVNAKLAQ---NPWMA---YLET------PKGFHCS 62
            |||   ...|.::...|.||  .::|. |.|....|:   .||||   ||.|      |   .|:
  Fly    65 ICC---PPPGNRLPSTEICG--QSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILP---FCA 121

  Fly    63 GTLINHLFVLTAAHCV---PDDL-LITVRLGE----YNTKTKVDC---DNHLCQEPFQEYNVDMG 116
            |:|||:.:|||:||||   |.|| |.:|||||    |:.....||   ||. |..|..|..::..
  Fly   122 GSLINNRYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQ-CALPNLEIKLEKI 185

  Fly   117 FRHRYYNANDQTN---DIGMLRLGRRVEYLNHIRPICI-----FASNRFQEPIDQLTWFTTTVWR 173
            ..|..:::....|   ||.:|||...|.|...|.||||     ||.::.:          ...|.
  Fly   186 IVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICIPKHGFFAKSKLE----------IAGWG 240

  Fly   174 ETAANATSKVLRTMNIDRQPKETCSEIYGW---NMTFEQICAGNTLS-QLCSTDSGAPQIRKMWH 234
            :|.....|:||....|..:....|:..:.:   |.:. |||||.... ..|..|||.|.:..|  
  Fly   241 KTNEGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSL-QICAGGYDGVDTCQGDSGGPLMVTM-- 302

  Fly   235 NGSDRYVQLGI---ASRVKGQCQNSGILMDLLSYADWIKRVVR 274
            :.|..|: .||   .|:..||....||.....::..|||.|:|
  Fly   303 DNSSVYL-AGITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVLR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 84/258 (33%)
Tryp_SPc 48..269 CDD:214473 81/255 (32%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 84/268 (31%)
Tryp_SPc 90..342 CDD:238113 86/269 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463475
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.