DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG5255

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:219 Identity:52/219 - (23%)
Similarity:82/219 - (37%) Gaps:55/219 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PHNISERSVNAKLAQNPWMAYLETPKGFH-CSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKT 95
            |:.||.:.:.:               |.| |.|.:|:..:::|||||.         .|...|..
  Fly    42 PYQISLQGIGS---------------GAHSCGGAIIDERWIITAAHCT---------RGRQATAF 82

  Fly    96 KV---DCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPI-----CIF 152
            :|   ..|.|  |...:.|..|....|..|......|||.:|.|...:.:.|..:|:     .:.
  Fly    83 RVLTGTQDLH--QNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALV 145

  Fly   153 ASNRFQEPIDQLT-WFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMT---FEQICAG 213
            ..:|.     .|| |.|.::..:..|.     |:::.::..|.|.|...:. |.|   ...:|..
  Fly   146 PGSRL-----LLTGWGTLSLGGDVPAR-----LQSLEVNYVPFEQCRAAHD-NSTRVDIGHVCTF 199

  Fly   214 NTLSQ-LCSTDSGAPQIRKMWHNG 236
            |...: .|..|||.|.:    |||
  Fly   200 NDKGRGACHGDSGGPLV----HNG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 49/203 (24%)
Tryp_SPc 48..269 CDD:214473 49/203 (24%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 52/219 (24%)
Tryp_SPc 30..252 CDD:238113 52/219 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437342
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.