DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG4053

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:270 Identity:67/270 - (24%)
Similarity:107/270 - (39%) Gaps:63/270 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RVQGFQMLLEEDCGI-PHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPD 80
            |:.|.|   |.:.|: |:.:|.:::        |..::       |||.::|..::|||.||..|
  Fly    34 RIVGGQ---EAEDGVAPYQVSIQTI--------WKTHI-------CSGVILNEQWILTAGHCALD 80

  Fly    81 ----DLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYN-ANDQTNDIGMLRLGRRV 140
                ||.|.|     .|..::        ||.|....|....|..|: .....|||.::.:...:
  Fly    81 FSIEDLRIIV-----GTNDRL--------EPGQTLFPDEALVHCLYDIPYVYNNDIALIHVNESI 132

  Fly   141 EYLNHIRPICIFASNRFQEPIDQLTWFTTTVW-RETAANATSKVLRTMNIDRQPKETCSEIYGWN 204
            .:.:..:   |...:|.|.|.....  |.|.| ...::..|.:.|:|:|:.....|.|.|.:.::
  Fly   133 IFNDRTQ---IVELSREQPPAGSTV--TLTGWGAPESSYPTVQYLQTLNLTIIAHEECRERWDFH 192

  Fly   205 --MTFEQICAGNTLSQ-LCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSGILM-----D 261
              :....||......: .||.|||.|   .||.......|..|.|      |   |:.|     :
  Fly   193 DGIDIGHICTFTREGEGACSGDSGGP---LMWEGKLVGLVNWGRA------C---GVGMPDMYAN 245

  Fly   262 LLSYADWIKR 271
            .:.|.|||:|
  Fly   246 TVYYQDWIRR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 60/238 (25%)
Tryp_SPc 48..269 CDD:214473 57/234 (24%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 64/266 (24%)
Tryp_SPc 35..256 CDD:238113 66/269 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.