DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG17475

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:309 Identity:73/309 - (23%)
Similarity:113/309 - (36%) Gaps:98/309 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IIGIAVICCLWRRVQGFQML-LEEDC--------GIPHNISERSVN---AKLAQNPWMAYLETPK 57
            |:.|.:.|..::.:...::. |.||.        |:  |...|.:|   .:|.:..:...|:...
  Fly     9 ILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGV--NFQNRVINGEDVQLGEAKYQISLQGMY 71

  Fly    58 GFH-CSGTLINHLFVLTAAHCV----PDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGF 117
            |.| |.|.:|:...||||||||    |..|.:.....||             ::|...|.|:..:
  Fly    72 GGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEY-------------EKPDAVYFVEEHW 123

  Fly   118 RHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLT-------------WFTT 169
            .|..||:.|..|||.::||...:::            |.:.:|.:..|             |.:|
  Fly   124 IHCNYNSPDYHNDIALIRLNDTIKF------------NEYTQPAELPTAPVANGTQLLLTGWGST 176

  Fly   170 TVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFE------QICAGNTLSQ-LCSTDSGAP 227
            .:|.:     |..:|:...:......||.||    |..:      .||...|..| .|..|||.|
  Fly   177 ELWGD-----TPDILQKAYLTHVVYSTCQEI----MNNDPSNGPCHICTLTTGGQGACHGDSGGP 232

  Fly   228 QIRKMWHNG--------------------SDRYVQL-GIASRVKGQCQN 255
                :.|||                    ::.|..| .|.|.:.|.|.|
  Fly   233 ----LTHNGVLYGLVNWGYPCALGVPDSHANVYYYLEWIRSMISGPCSN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 62/254 (24%)
Tryp_SPc 48..269 CDD:214473 62/254 (24%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 60/255 (24%)
Tryp_SPc 50..269 CDD:238113 60/256 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437343
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.