DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG31265

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:246 Identity:53/246 - (21%)
Similarity:93/246 - (37%) Gaps:50/246 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AKLAQNPWMAYLETPKGFH-CSGTLINHLFVLTAAHCVPDDL--LITVRLGEYNTKTKVDCDNHL 103
            |::...|:...|:...|.| |.|.::|..:::||.|||.:.:  |:.|..|           .:.
  Fly    43 AEIGFAPYQVSLQPIVGSHNCGGAILNENWIITAGHCVENFIPALVNVITG-----------TNK 96

  Fly   104 CQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFT 168
            ..||...|......:|..|:.....|||.:::|...:.:....:||.:..     .|:.......
  Fly    97 WAEPGAIYYTAEIHKHCMYDQPYMHNDIALVKLTENITFNELTQPIALPT-----RPVQLGEEIV 156

  Fly   169 TTVW-RETAANATSKVLRTMNIDRQPKETCSEIYG--WNMTFEQICAGNTLSQ----LCSTDSGA 226
            .|.| .:.|..::.:.|..:.:...|.:.|.|.:.  .:|....||   |.|:    .|..|||.
  Fly   157 LTGWGSDVAYGSSMEDLHKLTVGLVPLDECYETFNRTSSMGVGHIC---TFSREGEGACHGDSGG 218

  Fly   227 PQIRKMWHNGS-------DRYVQLGIASRVKGQCQNSGILMDLLSYADWIK 270
            |.:    .||.       .|...:|:..          :..::..|.|||:
  Fly   219 PLV----SNGQLVGVVNWGRPCGVGLPD----------VQANVYYYLDWIR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 52/240 (22%)
Tryp_SPc 48..269 CDD:214473 50/237 (21%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 51/243 (21%)
Tryp_SPc 39..257 CDD:238113 53/246 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.