DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and modSP

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:320 Identity:76/320 - (23%)
Similarity:116/320 - (36%) Gaps:88/320 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WRRVQGFQMLLEEDCG-IPHNISERSVNAKLAQN---PWMAYL-----ETPKGFHCSGTLINHLF 70
            |.|  |.|. .|:||| :...|.:.|.......|   ||...|     |....|.|.|:|:....
  Fly   347 WNR--GRQR-CEQDCGQLATPIKQFSSGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDL 408

  Fly    71 VLTAAHCVPDD-----------LLITVRL----GEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHR 120
            |:||||||.|:           .:|..:.    ||...:.|        :...:...:..|::.|
  Fly   409 VITAAHCVYDEGTRLPYSYDTFRVIAAKFYRNYGETTPEEK--------RRDVRLIEIAPGYKGR 465

  Fly   121 ---YYNANDQTNDIGMLRLGRRVEYLNHIRPICI-FASNRFQEPIDQLTWFTTTVWR-------- 173
               ||      .|:.:|.|....|..:.|||||: |||...:|.:..........|.        
  Fly   466 TENYY------QDLALLTLDEPFELSHVIRPICVTFASFAEKESVTDDVQGKFAGWNIENKHELQ 524

  Fly   174 -ETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKM----- 232
             ..|.:.::.|.|....|.|..:.|        .|.|   |.:|:  |..|||.....::     
  Fly   525 FVPAVSKSNSVCRRNLRDIQADKFC--------IFTQ---GKSLA--CQGDSGGGFTSELPTNAF 576

  Fly   233 --WHNGSDRYVQLGIASRVKG--QCQNS-GILMDLLSYADWIKRVVRQYGPSTDMNRSLK 287
              |:..  |:...|:.|....  ||.:| .::.::..:.|.|...         ||||::
  Fly   577 STWNTA--RHFLFGVISNAPNADQCAHSLTVMTNIQHFEDMILNA---------MNRSVE 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 61/266 (23%)
Tryp_SPc 48..269 CDD:214473 60/263 (23%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512 4/9 (44%)
Tryp_SPc 371..616 CDD:214473 61/273 (22%)
Tryp_SPc 371..591 CDD:304450 56/248 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437339
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.