DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG31326

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:288 Identity:70/288 - (24%)
Similarity:108/288 - (37%) Gaps:77/288 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GIPHNISERSVNAKL---------AQNPWMAYL-----ETPKGFHCSGTLINHLFVLTAAHC--- 77
            |||.. .||:....|         .|.||:..:     .....|.|.||||:...||:||||   
  Fly   260 GIPCG-RERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRA 323

  Fly    78 ----VPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEY-NVDMGFRHRYYNANDQTN-DIGMLRL 136
                :|...| .|.||.          |.|......|: .|.....|..:.....|. |:.::||
  Fly   324 PGRDLPASRL-AVSLGR----------NTLAIHSDGEFRGVSQLIIHENFQFKQFTEADLALVRL 377

  Fly   137 GRRVEYLNHIRPICIFA-SNRFQEP-----------IDQLTWFTTTVWRETAANATSK---VLRT 186
            ...|.|.::|.|||::: |||...|           .|:.....|.|.:.|..|..|:   .|..
  Fly   378 DEPVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALEL 442

  Fly   187 MNIDRQPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAP-QIRKMWHNGSDRYVQLGIAS--- 247
            .::..||              ..:||..|.:..|::|.|.| .:|:     .|.:|..|:.|   
  Fly   443 PHVLVQP--------------SSLCAKKTGAGPCASDGGGPLMLRE-----QDVWVLRGVISGGV 488

  Fly   248 --RVKGQCQNS--GILMDLLSYADWIKR 271
              ..:..|:.|  .:..|:..:.:|:::
  Fly   489 INEKENTCELSKPSVFTDVAKHIEWVRQ 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 63/261 (24%)
Tryp_SPc 48..269 CDD:214473 62/257 (24%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 64/270 (24%)
Tryp_SPc 277..514 CDD:214473 63/266 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436570
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.