DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG9649

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:275 Identity:69/275 - (25%)
Similarity:106/275 - (38%) Gaps:72/275 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 HNISERSVNAKLAQNPWMAYLETPKG----FHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNT 93
            ||    .:..:..|.||||.|....|    |.|.||||:...|::||||        .|.|..|.
  Fly   258 HN----GIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHC--------FRFGSRNL 310

  Fly    94 KTKVDCDNHLCQEPFQEYNVDMG------------------FRHRYYNANDQTN-DIGMLRLGRR 139
                         |.:...|.:|                  ..|..||.|..|: |:.:|:|...
  Fly   311 -------------PGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVYTDADLALLQLSNH 362

  Fly   140 VEYLNHIRPICIFASNRFQE-PIDQLTWFTTTVWRE-TAANATSKVLRTMNIDRQPKETC----S 198
            |:..::|:|||::..|...| |....::  ...|.| ...|..:::.:..:.|...:..|    |
  Fly   363 VDIGDYIKPICLWNENFLLELPSGHKSY--VAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLS 425

  Fly   199 EIYGWNMTFEQICAGNT-LSQLCSTDSGAP---QIRKMWHNGSDRYVQLGIAS---RVKGQCQNS 256
            |.....:|...|||.|. .|..||.|||..   |.:.:|       :..|:.|   |:..:|..:
  Fly   426 EENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQDIW-------MLRGVVSAGQRMTNRCNLT 483

  Fly   257 --GILMDLLSYADWI 269
              .|..|:..:.:|:
  Fly   484 LPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 66/260 (25%)
Tryp_SPc 48..269 CDD:214473 65/258 (25%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 68/273 (25%)
Tryp_SPc 259..497 CDD:214473 67/271 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436603
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.