DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG8870

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:246 Identity:79/246 - (32%)
Similarity:104/246 - (42%) Gaps:38/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GIAVICC-LWRRVQGFQMLLEEDCGIPHNISERSVNAKLAQNPWMAYL-----------ETPKGF 59
            |...:|| .|.     ..|..:.||.......:.....|.:.||||.|           ..||  
  Fly    59 GTNKVCCPKWE-----TYLPHDTCGQSRRKPTKGKIPALNEFPWMAMLLYGNKNNLSQKLVPK-- 116

  Fly    60 HCSGTLINHLFVLTAAHCVPDDL------LITVRLGEYNTKTKVD---CDNHLCQEP-FQEYNVD 114
             |.|:|||:.:||||||||....      |.||||||:||.|..|   .:......| :.|..||
  Fly   117 -CGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVD 180

  Fly   115 MGFRHRYYNANDQ-TNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAAN 178
            ....|..:|...: .|||.::||...|.|...|:|||:   .|.|:.......|..:.|.:....
  Fly   181 QIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICL---PRAQKLAAHKRKFQASGWPDMGQG 242

  Fly   179 ATSKV-LRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQLCST-DSGAP 227
            ..|:| ||:...:|.| :.|...|.:|:. .|||||.......|. |||.|
  Fly   243 IASEVLLRSFIAERHP-DVCKSNYDFNLG-SQICAGGLDGNDTSPGDSGGP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 71/204 (35%)
Tryp_SPc 48..269 CDD:214473 71/204 (35%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 71/207 (34%)
Tryp_SPc 93..337 CDD:214473 71/207 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463480
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.