DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG13318

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:289 Identity:68/289 - (23%)
Similarity:114/289 - (39%) Gaps:57/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VICCLWRRVQGFQMLLEEDCG-----IPHNISERSVNAKLAQNPWMAYLETPKGFHC-SGTLINH 68
            |.||   :...:|      ||     .|.:.:.....|.....||.|.|.|....:. .|.||..
  Fly   141 VACC---QAGSYQ------CGRRFPPPPGSTTAAPGQASFGAYPWQAALLTTADVYLGGGALITA 196

  Fly    69 LFVLTAAHCVPDDLLIT---VRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTND 130
            ..||||||.| .:|.:|   |||||::..:..:      ..|.|:..:...:.:..:|.|:..||
  Fly   197 QHVLTAAHKV-YNLGLTYFKVRLGEWDAASTSE------PIPAQDVYISNVYVNPSFNPNNLQND 254

  Fly   131 IGMLRLGRRVEYLNH--IRPICIFASNRFQEPIDQLTWFTTTVWRET---AANATSKVLRTMNID 190
            :.:|:|...|...:.  :..:|: .:..|   :.|..|  ...|.:.   |..|...:.|.:::.
  Fly   255 VAILKLSTPVSLTSKSTVGTVCL-PTTSF---VGQRCW--VAGWGKNDFGATGAYQAIERQVDVP 313

  Fly   191 RQPKETCSEI-----YGWNMTFEQ---ICAGNTLSQ-LCSTDSGAPQI---RKMWHNGSDRYVQL 243
            ..|...|...     .|.:.....   ||||....: .|:.|.|:|.:   ..:|      || :
  Fly   314 LIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLVCTSNGVW------YV-V 371

  Fly   244 GIASRVKGQCQNS--GILMDLLSYADWIK 270
            |:.:...|..|..  |:.:::.:|..||:
  Fly   372 GLVAWGIGCAQAGVPGVYVNVGTYLPWIQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 60/246 (24%)
Tryp_SPc 48..269 CDD:214473 58/243 (24%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 61/252 (24%)
Tryp_SPc 169..399 CDD:214473 59/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435541
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.