DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Sp7

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:271 Identity:80/271 - (29%)
Similarity:127/271 - (46%) Gaps:33/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPHNISERSVNAK---LAQNPWMAYLE-----TPKGFHCSGTLINHLFVLTAAHCVPDDL--- 82
            || ||:.|.:..|..   :.:..|||.||     ..:...|.|:|||:.:||||||||...:   
  Fly   128 CG-PHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVETE 191

  Fly    83 ---LITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYN-AN-DQTNDIGMLRLGRRVEY 142
               |.|||||||:|...|||.:.:|.:|..:..::....|..|: || ::.:||.:|||.|.|..
  Fly   192 VGHLTTVRLGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIALLRLDRPVVL 256

  Fly   143 LNHIRPICI-FASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGW--- 203
            ..:|:|:|: ..|.|......:|  ...:.|..|.....|.:.:.:::.....:.|:..:..   
  Fly   257 NEYIQPVCLPLVSTRMAINTGEL--LVVSGWGRTTTARKSTIKQRLDLPVNDHDYCARKFATRNI 319

  Fly   204 NMTFEQICAGNTL-SQLCSTDSGAPQIRKMWHNGSDR-YVQLGIASRVKGQCQNS---GILMDLL 263
            ::...|:|.|... ...|..|||.|.:|:    |.|: :.|.|:.| ...:|...   |:...:.
  Fly   320 HLISSQLCVGGEFYRDSCDGDSGGPLMRR----GFDQAWYQEGVVS-FGNRCGLEGWPGVYTRVA 379

  Fly   264 SYADWIKRVVR 274
            .|.|||...:|
  Fly   380 DYMDWIVETIR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 73/245 (30%)
Tryp_SPc 48..269 CDD:214473 71/242 (29%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 72/255 (28%)
Tryp_SPc 137..388 CDD:238113 74/257 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.