DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Prss45

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001008864.1 Gene:Prss45 / 408244 RGDID:1303021 Length:330 Species:Rattus norvegicus


Alignment Length:301 Identity:67/301 - (22%)
Similarity:111/301 - (36%) Gaps:59/301 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EEDCGIP---HNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVR 87
            |..||.|   .::.||.      ..||...|:......|.|.||:..:|::||||:..:....|.
  Rat    43 EPVCGAPWWSDSLEERH------HWPWEVSLQIENEHVCGGALIDQSWVVSAAHCIQGNKEYLVM 101

  Fly    88 LGE---------YNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYL 143
            ||.         :..|..|.               |:....:|:..|...:||.:|.|...|.:.
  Rat   102 LGSSTLQPSGSPWALKIPVG---------------DIIMHPKYWGQNFIRSDIALLCLETPVTFN 151

  Fly   144 NHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTM-----NIDRQPKETCSEIYGW 203
            .:|:|||: ..:.|...:....|  .|.|.:...:.::|:.|::     .:.....:.|..::..
  Rat   152 KYIQPICL-PEHNFNLKVGMKCW--VTGWGQAKQHPSAKLTRSLELWEAEVSIVDNKNCDRVFHK 213

  Fly   204 NMTFEQ---------ICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKG--QCQNSG 257
            ...:.|         ||..|.....|..|.|.|...:: |.   |::..||.|..|.  :..|..
  Rat   214 KTFYPQVIPLIRKNMICTTNHRENPCYGDPGGPLACEV-HG---RWILAGIFSWEKACTKAPNLS 274

  Fly   258 ILMDLLSYADWIKRVVRQYGPSTDMNRS---LKKWVDKIPV 295
            :...:..|..|||..|.:...|.....|   ...|:.::||
  Rat   275 VYTRIDKYTGWIKEQVSRGARSGRCRTSCLLFLPWLLQLPV 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 55/248 (22%)
Tryp_SPc 48..269 CDD:214473 52/245 (21%)
Prss45NP_001008864.1 Tryp_SPc 57..289 CDD:238113 57/259 (22%)
Tryp_SPc 57..286 CDD:214473 54/256 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.