DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:243 Identity:61/243 - (25%)
Similarity:100/243 - (41%) Gaps:36/243 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCV-----PDDLLITVRLGEYNTKTKVDCD 100
            :|:..:.||.|.|:......|..|||::.:::|||||.     |.|..::.              
  Rat   192 DAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHCFVRSANPKDWKVSF-------------- 242

  Fly   101 NHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICI-FASNRFQEPIDQL 164
            ..|..:|..:..|.....|..|:.....|||.::||...|.|.|:||..|: .|:.:|....|  
  Rat   243 GFLLSKPQAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIRRACLPEATQKFPPNSD-- 305

  Fly   165 TWFTTTVWRETAANATS-KVLRTMNIDRQPKETCS--EIYGWNMTFEQICAGNTLSQL--CSTDS 224
              ...|.|....::..| .:|:...:.....:||:  :.||..:|...:|||....::  |..||
  Rat   306 --VVVTGWGTLKSDGDSPNILQKGRVKIIDNKTCNSGKAYGGVITPGMLCAGFLEGRVDACQGDS 368

  Fly   225 GAPQIRKMWHNGSDRYVQLGIASRVKGQC---QNSGILMDLLSYADWI 269
            |.|.:.:   :....:...||.| ...:|   ...|:...:..|.|||
  Rat   369 GGPLVSE---DSKGIWFLAGIVS-WGDECALPNKPGVYTRVTHYRDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 60/236 (25%)
Tryp_SPc 48..269 CDD:214473 58/234 (25%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 59/241 (24%)
Tryp_SPc 187..415 CDD:238113 61/243 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.