DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and prss29

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001001228.1 Gene:prss29 / 407909 XenbaseID:XB-GENE-6453402 Length:330 Species:Xenopus tropicalis


Alignment Length:273 Identity:68/273 - (24%)
Similarity:114/273 - (41%) Gaps:55/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLI---TVRLGEYNTKTKVDCDNHLCQEPFQ 109
            ||...||...||.|.|:|:...:|||||||. |.:.:   |..||.|...   |.||.:.:   .
 Frog    38 PWQISLEFEGGFLCGGSLLTDSWVLTAAHCF-DSMNVSKYTAYLGVYQLS---DLDNAVLR---G 95

  Fly   110 EYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVW-- 172
            ..|:.:   |..|.....:.||.::.|...:.:...|:|:|: .|.....|:..:.|  .|.|  
 Frog    96 VKNITV---HPDYMYEGSSGDIALIELEEPIVFTPSIQPVCL-PSQDVPLPMGTMCW--VTGWGN 154

  Fly   173 -RETAANATSKVLRTMNIDRQPKETCSEIYGWNMTF---------EQICAGNTLSQL--CSTDSG 225
             :|.......:.|:...:....:.:|..:|..::.:         :.||||....::  |..|||
 Frog   155 IKENTPLEDPQTLQKAEVGLINRTSCEAMYQSSLGYRPSIHLIQDDMICAGYKQGKIDACQGDSG 219

  Fly   226 APQIRKMWHNGSDRYVQLGIASRVKG--QCQNSGILMDLLSYADWIKRVVRQYGPS--------- 279
            .|.:    .|.|:.::|.||.|...|  :....|:..::..|..||:.:|    ||         
 Frog   220 GPLV----CNTSNTWLQFGIVSWGLGCAEPNQPGVYTNVQYYLTWIQELV----PSVMFCDGEPS 276

  Fly   280 ------TDMNRSL 286
                  ||:::|:
 Frog   277 IATTTFTDLSQSV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 62/242 (26%)
Tryp_SPc 48..269 CDD:214473 60/239 (25%)
prss29NP_001001228.1 Tryp_SPc 26..263 CDD:238113 62/241 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.