DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG9372

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:269 Identity:74/269 - (27%)
Similarity:111/269 - (41%) Gaps:52/269 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EEDCGIPHNISERSVNAKLAQN---PWMAYL--ETPKGFHCSGTLINHLFVLTAAHCV----PDD 81
            :..|||......|....:.|:.   ||||.|  |......|.|.||....|||||||:    .:|
  Fly   161 QRGCGITSRQFPRLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKED 225

  Fly    82 LLITVRLGEYNTKTKVDCDNHLCQEP-FQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNH 145
              |.||||||||        |:..|. .:::.:.....|..||..:..|||.::|:.|...:..:
  Fly   226 --IFVRLGEYNT--------HMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTY 280

  Fly   146 IRPICIFASNRFQEPIDQLTWFTTTVWRETAANAT-----------SKVLRTMNIDRQPKETCSE 199
            |.|:|:       .|:::       .|.:..|..|           |.:|..:|:....:..|..
  Fly   281 IWPVCM-------PPVNE-------DWSDRNAIVTGWGTQKFGGPHSNILMEVNLPVWKQSDCRS 331

  Fly   200 IYGWNMTFEQICAG--NTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVK--GQCQNSGILM 260
            .:..::....:|||  ......|..|||.|.:.::   .:.|:|.:||.|...  ||....||..
  Fly   332 SFVQHVPDTAMCAGFPEGGQDSCQGDSGGPLLVQL---PNQRWVTIGIVSWGVGCGQRGRPGIYT 393

  Fly   261 DLLSYADWI 269
            .:..|.|||
  Fly   394 RVDRYLDWI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 69/244 (28%)
Tryp_SPc 48..269 CDD:214473 67/242 (28%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 69/255 (27%)
Tryp_SPc 176..402 CDD:238113 68/252 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.